A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10009
Swiss-prot Accession number	P09682 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Produced by the X-cells of the islets of pancreas
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	36 Amino acids
Molecular weight	4236
References	1  PubMed abstract 3311036
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HTDGIFSSDYSKYLDNRRTKDFVQWLLSTKRNGANT
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10486
Swiss-prot Accession number	P68076 (Sequence in FASTA format)
Description	Gonadoliberin-2 (Gonadoliberin II) (Gonadotropin-releasing hormone II)(GnRH-II) (Luteinizing hormone-releasing hormone II) (LH-RH II)(Luliberin II).
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	10 Amino acids
Molecular weight	1254
References	1  PubMed abstract 1678723
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (1-10)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10493
Swiss-prot Accession number	P69058 (Sequence in FASTA format)
Description	Oxytocin (Ocytocin).
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	9 Amino acids
Molecular weight	1010
References	1  PubMed abstract 5366118
Domain Name	N/A
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (1-9)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10842
Swiss-prot Accession number	P68992 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3780981 2  PubMed abstract 2646172
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	VPTQRLCGSHLVDALYFVCGERGFFYSPKPIRELEPLL
Position of mature hormone in Pre-Hormone protein	38 Residues from position (1-38)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10843
Swiss-prot Accession number	P68992 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Hydrolagus colliei (Spotted ratfish) (Pacific ratfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Holocephali; Chimaeriformes; Chimaeridae; Hydrolagus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	59 Amino acids
Molecular weight	6606
References	1  PubMed abstract 3780981 2  PubMed abstract 2646172
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLANLEGYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (39-59)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated